1
actividadesdeinfantilyprimaria.com
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
106.6K27/100
semantic_text_similarity
similar_rank_band
similar_traffic_rank
Quick read
How to read 1-notes.com quickly
1-notes.com looks like an uncategorized property. Traffic signals point to roughly 29.5K monthly visits. Current AI trust scoring is 74/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
53/74 fields populated (72%)
1 health alerts13 providers
Providers with missing fields
ads: 3/5authority: 0/5history: 3/7traffic: 15/16radar: 2/4ai: 0/7
Provider health alerts
authority: AHREFS_DR_FETCH_FAILED
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
Keep exploring
Keep exploring from this report
Browse the related category, topic, or technology path, open alternatives, or move into comparison when you have a second domain.
Related technology
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
Technology pages help you compare implementation patterns across similar sites.
Alternatives
Open 1-notes.com alternatives
Review similar domains ranked by category, audience, technology overlap, and match reasons.
Use alternatives when this report is the start of a shortlist.
Comparison
Compare similar domains
Choose an alternative and move into a side-by-side comparison from the alternatives path.
Use compare pages once you have two candidate domains.