Live website intelligence
3DEarth - Home
Welcome to 3DEarth! We provide free and fast directions and maps that are designed to make your travels easy and fun. In addition to driving directions, 3DEarth provides bus and transit directions as well as a flight tracker. 3DEarth uses state-of-the-art technology to ensure that we always provide the best routes available and factor in live traffic to get you to your destination on-time.
Last refresh
Updated 11d ago
Analyst read
Professional
#10.6M global rank22/100 trustMaps & NavigationStale snapshot
Detected stack
ReactCloudflare
Quick read
How to read 3dearth.co quickly
3dearth.co looks like maps & navigation. Traffic signals point to roughly 2.0K monthly visits. Current AI trust scoring is 22/100.
What to do next
- The stack appears to include React, Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
40/56 fields populated (71%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3whois: 0/6radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
3DEarth appears to offer a web-based navigation platform providing free driving, transit, and flight-tracking tools with live traffic-aware routing.
Business ModelFree digital service (ad-supported or lead-generation likely)
Target AudienceEveryday travelers, commuters, and drivers seeking quick route and map directions online
Classification
CategoryMaps & Navigation
Sub-CategoryNavigation Apps & Services
mapsdirectionsroute-planningtraffictransitflight-trackertravelweb-app
Trust & Risk
Trust Assessment
Trust Score22/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtFound
Ad Systems
appnexus.comimprovedigital.comcontextweb.compubmatic.comopenx.comtriplelift.comteads.tvadmanmedia.comsharethrough.comemxdgt.comyahoo.comsmartadserver.comadagio.ioonetag.comspotx.tvspotxchange.comadform.comfreewheel.tvgoogle.comindexexchange.comrhythmone.comvideo.unrulymedia.comsspx.techyieldlab.netsmartstream.tvxandr.comimpactify.iorubiconproject.comadvertising.comsovrn.comlijit.comgitberry.comthemediagrid.comaps.amazon.comsmaato.comadtech.comad-generation.jpdistrictm.ioyieldmo.comgumgum.comheaderlift.comadyoulike.comloopme.compubnative.netxad.comamxrtb.comaol.comconnectad.io33across.comadmixer.net
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleCorporate
VibeInnovative
UI Score7/100
Detected Logo Text3DEarth
IAB Taxonomy
IAB CategoryMaps & Navigation
IAB Sub-CategoryNavigation Apps & Services
Confidence95%
mapsdirectionsroute-planningtraffictransitflight-trackertravelweb-app
Business Insights
Business Model
Free digital service (ad-supported or lead-generation likely) model detected
Trust Level
Low trust with 22/100 score
Audience
Everyday travelers, commuters, and drivers seeking quick route and map directions online
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Maps & Navigation sites
Move from this single report into the broader market cluster.
Browse Navigation Apps & Services sites
Use the topic route when audience and editorial intent matter more than category.
Browse React websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
acomodeo.com
similar_rank_band
1channel.it
similar_rank_band
airtrfx.com
similar_rank_band
asa-dmc.com
similar_rank_band
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.