Quick read
3punchiebukuro.info looks like news / information. Traffic signals point to roughly 230.0K monthly visits. Current AI trust scoring is 42/100.
What to do next
46/56 fields populated (82%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse News / Information sites
Move from this single report into the broader market cluster.
Browse How-To & Advice sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
actividadesdeinfantilyprimaria.com
similar_rank_band
autobild.bg
similar_rank_band
autoblog.it
similar_rank_band
insidetogo.com
same_category
See all alternatives
View all 6 alternatives and competitors to 3punchiebukuro.info.
Why this module matters
This page lists websites that share audience, category, or technology overlap with the current domain. Use it to discover competitors, substitutes, and adjacent players.
AgelessRx: Anti-Aging Treatments Backed by Longevity Science
News, Video, Prove e Recensioni sulle automobili | Autoblog
Desi Indian sex photos at Antarvasna Photos
Food Safety Training Online – Learn & Get Certified Fast
Ini Surabaya - Informasi Gaya Hidup, Hiburan, Edukasi, Otomotif
Inilah Kuningan - Portal Berita Kuningan
FAQ
Common questions about finding and comparing alternatives.
This page lists websites that share audience, category, or technology overlap with 3punchiebukuro.info. Each alternative includes a match score and reasons so you can evaluate relevance quickly.
Alternatives are identified using a combination of category taxonomy, technology stack overlap, traffic patterns, and audience similarity signals from the SiteJSON analysis pipeline.
Yes. Click any alternative to open its full report, or use the compare feature to see 3punchiebukuro.info side by side with a competitor.