Quick read
How to read 4kup.net quickly
4kup.net looks like adult content. Traffic signals point to roughly 291.4K monthly visits. Current AI trust scoring is 86/100.
What to do next
- The stack appears to include WordPress, Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
46/56 fields populated (82%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
A WordPress-based adult image aggregation site showcasing explicit model photo posts and linking out to external sources.
Business ModelMedia/Aggregator (affiliate-style outbound traffic)
Target AudienceAdults seeking explicit glamour/adult model photo content, likely male-skewing NSFW traffic.
Classification
CategoryAdult Content
Sub-CategoryAdult Entertainment
adultmodelsphoto collectionwordpressexternal linksnsfw
Trust & Risk
Trust Assessment
Trust Score86/100
SentimentSpammy
Spam DetectionFlagged
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleMinimalist blog/magazine WordPress theme
VibeEdgy
UI Score4/100
Detected Logo TextBeautiful Girls Collection
IAB Taxonomy
IAB CategoryAdult Content
IAB Sub-CategoryAdult Entertainment
Confidence98%
adultmodelsphoto collectionwordpressexternal linksnsfw
Business Insights
Business Model
Media/Aggregator (affiliate-style outbound traffic) model detected
Trust Level
High trust with 86/100 score
Audience
Adults seeking explicit glamour/adult model photo content, likely male-skewing NSFW traffic.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Adult Content sites
Move from this single report into the broader market cluster.
Browse Adult Entertainment sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
adfh.world
same_category
actividadesdeinfantilyprimaria.com
similar_rank_band
4k69.com
similar_rank_band
hath.network
same_category
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.