Quick read
How to read 88db.com.hk quickly
88db.com.hk looks like business. Traffic signals point to roughly 1.2K monthly visits. Current AI trust scoring is 24/100.
What to do next
- The stack appears to include React, Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
40/56 fields populated (71%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3whois: 0/6radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
A Hong Kong Chinese-language service directory and listings platform where users can search for home and commercial services/products, and merchants can post ads to promote offerings.
Business ModelClassifieds/Marketplace with advertising lead-generation
Target AudienceConsumers and businesses in Hong Kong seeking local services, products, and rentable spaces, plus merchants wanting online exposure.
Classification
CategoryBusiness
Sub-CategoryAdvertising
Hong Konglocal servicesclassifiedsmarketplaceworkspace listingsservice directoryChinese language
Trust & Risk
Trust Assessment
Trust Score24/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtFound
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleModern marketplace with card-based promotional layout
VibeProfessional
UI Score7/100
Detected Logo Text88db
IAB Taxonomy
IAB CategoryBusiness
IAB Sub-CategoryAdvertising
Confidence88%
Hong Konglocal servicesclassifiedsmarketplaceworkspace listingsservice directoryChinese language
Business Insights
Business Model
Classifieds/Marketplace with advertising lead-generation model detected
Trust Level
Low trust with 24/100 score
Audience
Consumers and businesses in Hong Kong seeking local services, products, and rentable spaces, plus merchants wanting online exposure.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Business sites
Move from this single report into the broader market cluster.
Browse Advertising sites
Use the topic route when audience and editorial intent matter more than category.
Browse React websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
accesspaysuite.com
same_category
aviator.aero
same_category
baby-bazar.cz
similar_rank_band
4media.info
similar_rank_band
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.