Live website intelligence
AcadCalendar | Academic Calendar and Important Dates
Stay on top of important dates and deadlines, add/drop dates, exam dates, holidays, move-in days, and academic events on AcadCalendar.com
Last refresh
Updated 15d ago
Analyst read
Professional
#749.7K global rank22/100 trustEducationStale snapshot
Detected stack
WordPress
Quick read
How to read acadcalendar.com quickly
acadcalendar.com looks like education. Traffic signals point to roughly 46.9K monthly visits. Current AI trust scoring is 22/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
51/56 fields populated (91%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
AcadCalendar appears to be an education-focused informational website that publishes academic calendars and key university date references such as add/drop deadlines, holidays, and exam periods.
Business ModelMedia
Target AudienceStudents, parents, and academic staff seeking centralized academic schedule and deadline information for colleges and universities.
Classification
CategoryEducation
Sub-CategoryCollege Education
academic calendarimportant datescollege deadlinesholidaysexam datesmove-in dayWordPress
Trust & Risk
Trust Assessment
Trust Score22/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtFound
Ad Systems
google.com
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleEditorial
VibeProfessional
UI Score6/100
Detected Logo TextAcad
IAB Taxonomy
IAB CategoryEducation
IAB Sub-CategoryCollege Education
Confidence94%
academic calendarimportant datescollege deadlinesholidaysexam datesmove-in dayWordPress
Business Insights
Business Model
Media model detected
Trust Level
Low trust with 22/100 score
Audience
Students, parents, and academic staff seeking centralized academic schedule and deadline information for colleges and universities.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse College Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
activehistory.ca
same_category
accelerate-ed.com
same_category
actividadesdeinfantilyprimaria.com
same_category
4aceswholesale.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to acadcalendar.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.