Quick read
academia.gal looks like education. Traffic signals point to roughly 285.2K monthly visits. Current AI trust scoring is 7/100.
What to do next
51/56 fields populated (91%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
This page lists websites that share audience, category, or technology overlap with the current domain. Use it to discover competitors, substitutes, and adjacent players.
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
Active History – History Matters
Amplify I High-quality K–12 curriculum & assessments I Homepage
ABCya! • Learning Games and Apps for Kids
Art of Problem Solving
ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ
FAQ
Common questions about finding and comparing alternatives.
This page lists websites that share audience, category, or technology overlap with academia.gal. Each alternative includes a match score and reasons so you can evaluate relevance quickly.
Alternatives are identified using a combination of category taxonomy, technology stack overlap, traffic patterns, and audience similarity signals from the SiteJSON analysis pipeline.
Yes. Click any alternative to open its full report, or use the compare feature to see academia.gal side by side with a competitor.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse Language Learning sites
Use the topic route when audience and editorial intent matter more than category.
Browse React websites
Pivot from one domain into a stack-based discovery path.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
actividadesdeinfantilyprimaria.com
same_category
activehistory.ca
same_category
amplify.com
same_category
abcya.com
same_category