Live website intelligence
Learn better, grow smarter. | Acco
Acco maakt studeren aan het hoger onderwijs en levenslang leren toegankelijk en betaalbaar via boek- en kantoorhandels, uitgeverij, drukkerij en met leeroplossingen voor bedrijven.
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
acco.be looks like education. Traffic signals point to roughly 54.1K monthly visits. Current AI trust scoring is 8/100.
What to do next
45/56 fields populated (80%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
These metrics help you decide whether a site is structured clearly enough for search and users. Strong heading, linking, and technical file patterns usually indicate better discoverability.
robots.txt
File found and accessible
sitemap.xml
Sitemap found and valid
Single H1 Tag
Found 0 H1 tags
Meta Description
Meta description present
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse Educational Resources sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
actividadesdeinfantilyprimaria.com
same_category
ahzassociates.com
same_category
ahl-alquran.com
similar_rank_band
activefibre.co.za
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to acco.be.