Live website intelligence
ACTE : No.1 Software Training Institute in India with Placements | Updated 2025
ACTE is the Best Software Training Institute for Java, Python, Cloud Computing, Data Science, AWS, DevOps, Software Testing, Selenium, Full Stack, Digital Marketing, Salesforce, ServiceNow, Cyber Security, Power BI in Chennai, Bangalore, Hyderabad, and Pune, India.
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
acte.in looks like education. Traffic signals point to roughly 108.0K monthly visits. Current AI trust scoring is 42/100.
What to do next
51/56 fields populated (91%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse Continuing Education / Online Learning sites
Use the topic route when audience and editorial intent matter more than category.
Browse React websites
Pivot from one domain into a stack-based discovery path.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
activehistory.ca
same_category
actividadesdeinfantilyprimaria.com
same_category
42.fr
same_category
amplify.com
same_category