Live website intelligence
Free Classifieds Sites, Post Free Ads, Global Ads Posting Site
AdProceed.com is a free classifieds website to post ads for jobs, real estate, vehicles, services, and products. Connect with local buyers and sellers easily.
Last refresh
Updated 13d ago
Analyst read
Spammy
#733.6K global rank65/100 trustTechnology & ComputingStale snapshot
Detected stack
WordPressCloudflare
Quick read
How to read adproceed.com quickly
adproceed.com looks like technology & computing. Traffic signals point to roughly 32.3K monthly visits. Current AI trust scoring is 65/100.
What to do next
- The stack appears to include WordPress, Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
51/56 fields populated (91%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
AdProceed.com operates as a free global classifieds advertising platform allowing users to post ads across categories including jobs, real estate, vehicles, services, and products. The site aims to connect local buyers and sellers.
Business ModelClassifieds Marketplace (Ad-supported/Freemium)
Target AudienceGeneral consumers and small businesses seeking free advertising channels, job seekers, property renters/buyers, and local service providers
Classification
CategoryTechnology & Computing
Sub-CategoryWeb Services
classifiedsfree-adsmarketplacewordpressglobal-adslocal-commerce
Trust & Risk
Trust Assessment
Trust Score65/100
SentimentSpammy
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtFound
Ad Systems
google.commgid.com
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleMinimalist
VibeBroken, Unprofessional
UI Score2/100
IAB Taxonomy
IAB CategoryTechnology & Computing
IAB Sub-CategoryWeb Services
Confidence75%
classifiedsfree-adsmarketplacewordpressglobal-adslocal-commerce
Business Insights
Business Model
Classifieds Marketplace (Ad-supported/Freemium) model detected
Trust Level
Medium trust with 65/100 score
Audience
General consumers and small businesses seeking free advertising channels, job seekers, property renters/buyers, and local service providers
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Technology & Computing sites
Move from this single report into the broader market cluster.
Browse Web Services sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
3dricambi.it
similar_rank_band
addustour.com
same_category
ipify.org
same_category
addtoany.com
same_category
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.