Skip to main content
Screenshot of adsverige.com

Live website intelligence

adsverige.com

Last refresh

Updated 14d ago

Analyst read

Professional

25/100 trustBusiness and FinanceStale snapshot

Quick read

How to read adsverige.com quickly

adsverige.com looks like business and finance. Traffic signals point to roughly 385.1K monthly visits. Current AI trust scoring is 25/100.

What to do next

  • Technology detection is incomplete, so infrastructure clues may be more useful than stack tags.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

visual: 0/4meta: 0/3seo: 0/5publisher: 3/5files: 2/3traffic: 8/10radar: 0/4ai: 6/7
View field-level status

visual: 0/4

Missing: screenshotUrl, dominantColor, palette, storage

meta: 0/3

Missing: title, description, techStackDetected

seo: 0/5

Missing: h1Count, h2Count, internalLinks, externalLinks, imagesCount

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 8/10

Missing: globalRank, countryRank

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 6/7

Missing: aiAnalysis.visualAnalysis

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

DNS & Infrastructure

DNS ProviderMicrosoft
Mail (MX)1 adsverige-com.mail.protection.outlook.com
NS Records2 records
TXT Records1 record

Traffic Stats

Monthly Visits385.1K
Bounce Rate32.00%
Avg Visit Duration3m 22.27000000000001s
Pages per Visit3.1
Top CountrySE
Domain Age28.2 years

Taxonomy

IAB CategoryBusiness and Finance
IAB Sub-CategoryAdvertising and Marketing
Confidence75%
advertisingclassifiedsmarketplaceswedenads

Technical Files

robots.txtMissing
sitemap.xmlMissing

AI Analysis

SummaryA Swedish classified advertising platform where users can post and browse advertisements, likely covering categories such as vehicles, real estate, jobs, and general goods.
Business ModelClassified Advertising Marketplace
Trust Score25/100
SentimentProfessional

Advertising

Is AdvertiserNo
Result Count0
no_advertiser_idno_creative_results

Publisher / Monetization

ads.txtMissing
Monetization Signals
missing_ads_txt

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.