Skip to main content
Screenshot of advortex.cloud

Live website intelligence

advortex.cloud

Last refresh

Updated 13d ago

Analyst read

Professional

25/100 trustTechnology & ComputingStale snapshot

Quick read

How to read advortex.cloud quickly

advortex.cloud looks like technology & computing. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 25/100.

What to do next

  • Technology detection is incomplete, so infrastructure clues may be more useful than stack tags.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

26/56 fields populated (46%)

11 providers

Providers with missing fields

visual: 0/4meta: 0/3seo: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4ai: 6/7
View field-level status

visual: 0/4

Missing: screenshotUrl, dominantColor, palette, storage

meta: 0/3

Missing: title, description, techStackDetected

seo: 0/5

Missing: h1Count, h2Count, internalLinks, externalLinks, imagesCount

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 6/7

Missing: aiAnalysis.visualAnalysis

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

DNS & Infrastructure

DNS ProviderOther
Mail (MX)10 diesonne-mail.sakura.ne.jp
NS Records4 records

Traffic Stats

Domain Age3.3 years

Taxonomy

IAB CategoryTechnology & Computing
IAB Sub-CategoryCloud Computing
Confidence65%
cloudadvertisingmarketingadtechplatform

Technical Files

robots.txtMissing
sitemap.xmlMissing

AI Analysis

SummaryAdVortex appears to be a cloud-based advertising or marketing technology platform, likely offering ad serving, campaign management, or programmatic advertising solutions based on the 'ad' prefix and 'vortex' suggesting data/activity aggregation combined with cloud infrastructure.
Business ModelSaaS
Trust Score25/100
SentimentProfessional

Advertising

Is AdvertiserNo
Result Count0
no_advertiser_idno_creative_results

Publisher / Monetization

ads.txtMissing
Monetization Signals
missing_ads_txt

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.