Live website intelligence
Empowering K-12 Education | Aeries SIS
Discover Aeries, the trusted K-12 Student Information System. Streamline school operations, enhance communication, and support student success.
Last refresh
Updated 11d ago
Analyst read
Professional
#383.7K global rank5/100 trustEducationStale snapshot
Detected stack
WordPress
Quick read
How to read aeries.com quickly
aeries.com looks like education. Traffic signals point to roughly 114.0K monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
51/56 fields populated (91%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Aeries provides a data-driven Student Information System (SIS) for K-12 school districts, helping streamline operations and support student success through actionable data analytics.
Business ModelSaaS
Target AudienceK-12 school districts, administrators, educators, and educational institutions in the United States
Classification
CategoryEducation
Sub-CategoryK-12 Education
Student Information SystemSISK-12Education TechnologyEdTechSchool ManagementData AnalyticsSaaS
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleCorporate
VibeTrustworthy
UI Score8/100
Detected Logo TextAeries
IAB Taxonomy
IAB CategoryEducation
IAB Sub-CategoryK-12 Education
Confidence95%
Student Information SystemSISK-12Education TechnologyEdTechSchool ManagementData AnalyticsSaaS
Business Insights
Business Model
SaaS model detected
Trust Level
Low trust with 5/100 score
Audience
K-12 school districts, administrators, educators, and educational institutions in the United States
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
activehistory.ca
same_category
actividadesdeinfantilyprimaria.com
same_category
azeusconvene.com
similar_rank_band
510families.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to aeries.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.