Live website intelligence
Agroads – Donde comprás y vendés todo para tu campo
Conectamos la oferta y demanda del sector agropecuario. Somos una comunidad de 600.000 personas vinculada al agro, con más de 75.000 ofertas de maquinaria agrícola, repuestos, campos, insumos y equipamiento rural en Argentina.
Last refresh
Updated 10d ago
Analyst read
Professional
#120.6K global rank15/100 trustBusiness & IndustrialStale snapshot
Detected stack
WordPress
Quick read
How to read agroads.com.ar quickly
agroads.com.ar looks like business & industrial. Traffic signals point to roughly 318.9K monthly visits. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
50/56 fields populated (89%)
Providers with missing fields
publisher: 3/5files: 2/3whois: 5/6radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 5/6
Missing: whois.registrar
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Agroads is Argentina's leading online marketplace for agricultural equipment and rural supplies, connecting buyers and sellers of farm machinery, spare parts, land, and agricultural inputs. The platform serves as a community hub for 600,000+ agricultural professionals with over 75,000 product listings.
Business ModelClassifieds Marketplace (B2B/B2C hybrid)
Target AudienceFarmers, agricultural producers, rural landowners, agricultural contractors, and businesses in the agricultural sector across Argentina
Classification
CategoryBusiness & Industrial
Sub-CategoryAgriculture
agriculturefarm-machineryclassifiedsmarketplaceargentinatractorsrural-equipmentagricultural-supplies
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txtno_ad_systems
AI Visual Analysis
Design StyleClean Corporate
VibeTrustworthy, Established, Practical
UI Score7/100
Detected Logo Textagroads
IAB Taxonomy
IAB CategoryBusiness & Industrial
IAB Sub-CategoryAgriculture
Confidence95%
agriculturefarm-machineryclassifiedsmarketplaceargentinatractorsrural-equipmentagricultural-supplies
Business Insights
Business Model
Classifieds Marketplace (B2B/B2C hybrid) model detected
Trust Level
Low trust with 15/100 score
Audience
Farmers, agricultural producers, rural landowners, agricultural contractors, and businesses in the agricultural sector across Argentina
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Business & Industrial sites
Move from this single report into the broader market cluster.
Browse Agriculture sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
adevinta.com
same_category
adexa.co.uk
same_category
adequasys.com
same_category
adendorff.co.za
same_category
See all alternatives
View all 6 alternatives and competitors to agroads.com.ar.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.