Skip to main content
Screenshot of aipornskinny.com

Live website intelligence

aipornskinny.com

Popular skinny AI Porn Pics & Nude skinny Porn Pictures

Last refresh

Updated 17d ago

Analyst read

Spammy

95/100 trustAdult ContentStale snapshot

Detected stack

Cloudflare

Quick read

How to read aipornskinny.com quickly

aipornskinny.com looks like adult content. Traffic signals point to roughly 452 monthly visits. Current AI trust scoring is 95/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

46/56 fields populated (82%)

11 providers

Providers with missing fields

publisher: 3/5files: 2/3traffic: 7/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 7/10

Missing: globalRank, countryRank, topCountry

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags1
H2 Tags0
Internal Links303
External Links7
Images100

DNS & Infrastructure

DNS ProviderCloudflare
NS Records2 records

Traffic Stats

Monthly Visits452
Bounce Rate52.00%
Avg Visit Duration0m 0s
Pages per Visit1.0
Domain Age2.4 years

Taxonomy

IAB CategoryAdult Content
IAB Sub-CategoryAdult Entertainment
Confidence99%
adultai-generatedpornographynsfwimage-galleryskinnynude

Technical Files

robots.txtFound
sitemap.xmlFound

AI Analysis

SummaryWebsite hosting AI-generated adult pornographic images featuring skinny/nude women in various categories and scenarios
Business ModelAdult Content/Media - Free gallery with likely ad-supported or premium upsell monetization
Trust Score95/100
SentimentSpammy

Advertising

Is AdvertiserNo
Result Count0
no_advertiser_idno_creative_results

Publisher / Monetization

ads.txtFound
Monetization Signals
has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#500000
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.