Quick read
alata.plus looks like education. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 10/100.
What to do next
34/56 fields populated (61%)
Providers with missing fields
visual: 0/4
Missing: screenshotUrl, dominantColor, palette, storage
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Use rank, visits, geography, and engagement signals together. No single metric is enough, but the combination is useful for prioritization and market sizing.
—
—
—
Monthly
—
—
—
Domain Age
2.9 years
Registrar
GoDaddy.com, LLC
Created At
Apr 11, 2023, 09:32 PM
Updated At
May 26, 2025, 09:32 PM
Expires At
Apr 11, 2026, 09:32 PM
Nameservers
Status
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse Educational Resources sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
actividadesdeinfantilyprimaria.com
same_category
tandfonline.com
same_category
asu.edu
same_category
umich.edu
same_category