Live website intelligence
Amalsholeh.com – #JembatanKebaikan
Amalsholeh.com adalah sebuah website untuk penggalangan dana dan berdonasi untuk beramal soleh secara online.
Last refresh
Updated 14d ago
Analyst read
Professional
#265.5K global rank15/100 trustNon-Profit & PhilanthropyStale snapshot
Detected stack
Unknown
Quick read
How to read amalsholeh.com quickly
amalsholeh.com looks like non-profit & philanthropy. Traffic signals point to roughly 178.7K monthly visits. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
51/56 fields populated (91%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Amalsholeh.com is an Indonesian Islamic crowdfunding and donation platform facilitating online charitable giving (zakat, infaq, sadaqah, wakaf). It positions itself as a 'bridge of goodness' connecting donors with various charitable programs, particularly active during Ramadan campaigns.
Business ModelDonation-based Crowdfunding Platform
Target AudienceIndonesian Muslim individuals and communities seeking to fulfill religious obligations and perform charitable acts, particularly during Ramadan; donors interested in transparent, program-specific giving
Classification
CategoryNon-Profit & Philanthropy
Sub-CategoryCharitable Donations
zakatinfaqsadaqahwakaframadanislamic charitycrowdfundingdonationindonesiafintech charity
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleWarm, Community-focused, Islamic-friendly
VibeTrustworthy, Welcoming, Faith-based, Urgent (during Ramadan)
UI Score7/100
Detected Logo Textamalsholeh
IAB Taxonomy
IAB CategoryNon-Profit & Philanthropy
IAB Sub-CategoryCharitable Donations
Confidence92%
zakatinfaqsadaqahwakaframadanislamic charitycrowdfundingdonationindonesiafintech charity
Business Insights
Business Model
Donation-based Crowdfunding Platform model detected
Trust Level
Low trust with 15/100 score
Audience
Indonesian Muslim individuals and communities seeking to fulfill religious obligations and perform charitable acts, particularly during Ramadan; donors interested in transparent, program-specific giving
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Non-Profit & Philanthropy sites
Move from this single report into the broader market cluster.
Browse Charitable Donations sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
ab.gr
similar_rank_band
avios.com
similar_rank_band
amaysim.com.au
similar_rank_band
anyshemale.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to amalsholeh.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.