Quick read
How to read anahwa.com quickly
anahwa.com looks like news & weather. Traffic signals point to roughly 47.2K monthly visits. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
51/56 fields populated (91%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Ana Hawa (أنا حوا) is an Arabic-language women's news and lifestyle portal based in Egypt, covering topics including health, beauty, family, social issues, and seasonal content like Ramadan coverage. The site appears to be a digital media publication targeting female audiences with news, lifestyle articles, and video content.
Business ModelDigital Media / Advertising-Supported Publishing
Target AudienceArabic-speaking women, primarily in Egypt and the broader Middle East region, interested in lifestyle, health, family, and social news content
Classification
CategoryNews & Weather
Sub-CategoryWomen's Interest News
womennewslifestylehealthramadanegyptarabicmedia
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtFound
Ad Systems
google.com
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleEditorial/Traditional News Portal
VibeInformative, Traditional, Female-Focused
UI Score5/100
Detected Logo Textأنا حوا
IAB Taxonomy
IAB CategoryNews & Weather
IAB Sub-CategoryWomen's Interest News
Confidence85%
womennewslifestylehealthramadanegyptarabicmedia
Business Insights
Business Model
Digital Media / Advertising-Supported Publishing model detected
Trust Level
Low trust with 15/100 score
Audience
Arabic-speaking women, primarily in Egypt and the broader Middle East region, interested in lifestyle, health, family, and social news content
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse News & Weather sites
Move from this single report into the broader market cluster.
Browse Women's Interest News sites
Use the topic route when audience and editorial intent matter more than category.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
aden-tm.net
same_category
007soccerpicks.com
similar_rank_band
addmefast.com
similar_rank_band
1businessworld.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to anahwa.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.