Quick read
How to read anzeigendeutschland.de quickly
anzeigendeutschland.de looks like e-commerce. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 65/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
33/56 fields populated (59%)
Providers with missing fields
publisher: 3/5files: 2/3traffic: 0/10whois: 0/6radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
German-language online classifieds marketplace (anzeigendeutschland.de) allowing users to post advertisements, buy and sell goods across multiple categories including vehicles, electronics, real estate, jobs, and services. Despite the .de domain and German interface, metadata confusingly references 'marketplace.ke' suggesting Kenya, indicating possible domain repurposing, template reuse, or SEO manipulation.
Business ModelC2C/B2C Classifieds Marketplace (Advertising-based or Freemium listing fees)
Target AudienceGerman-speaking consumers and businesses looking to buy, sell, or trade goods and services locally or nationally
Classification
CategoryE-Commerce
Sub-CategoryMarketplace
classifiedsmarketplacegermanyauctionsbuy-sellc2cb2c
Trust & Risk
Trust Assessment
Trust Score65/100
SentimentSpammy
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtFound
Ad Systems
google.com
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleFunctional/Traditional
VibeDated, Unfinished, Suspicious
UI Score4/100
Detected Logo Textanzeigendeutschland.de
IAB Taxonomy
IAB CategoryE-Commerce
IAB Sub-CategoryMarketplace
Confidence85%
classifiedsmarketplacegermanyauctionsbuy-sellc2cb2c
Business Insights
Business Model
C2C/B2C Classifieds Marketplace (Advertising-based or Freemium listing fees) model detected
Trust Level
Medium trust with 65/100 score
Audience
German-speaking consumers and businesses looking to buy, sell, or trade goods and services locally or nationally
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse E-Commerce sites
Move from this single report into the broader market cluster.
Browse Marketplace sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
kleinanzeigen.com
high_tag_overlap
institutfrancais.de
high_tag_overlap
lacentrale.fr
high_tag_overlap
allestate.pro
high_tag_overlap
See all alternatives
View all 6 alternatives and competitors to anzeigendeutschland.de.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.