Quick read
How to read apsbank.com.mt quickly
apsbank.com.mt looks like finance. Traffic signals point to roughly 78.5K monthly visits. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
45/56 fields populated (80%)
Providers with missing fields
publisher: 3/5files: 2/3whois: 0/6radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
APS Bank is a Maltese financial institution providing banking services. The screenshot shows an Imperva security checkpoint page, indicating the bank uses enterprise-grade DDoS and bot protection for their online banking platform.
Business ModelTraditional Banking with Digital Services
Target AudienceRetail and commercial banking customers in Malta seeking secure online financial services
Classification
CategoryFinance
Sub-CategoryBanking
bankcybersecuritycaptchaimpervafinancial-servicesmalta
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserActive Advertiser
Advertiser Names
APS Bank plc
Advertiser IDs
AR01019546758427967489
Ad Count1
has_advertiser_idhas_creative_results
Publisher Monetization
ads.txtFound
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleCorporate Security
VibeTrustworthy
UI Score6/100
Detected Logo TexthCaptcha
IAB Taxonomy
IAB CategoryFinance
IAB Sub-CategoryBanking
Confidence95%
bankcybersecuritycaptchaimpervafinancial-servicesmalta
Business Insights
Business Model
Traditional Banking with Digital Services model detected
Trust Level
Low trust with 15/100 score
Audience
Retail and commercial banking customers in Malta seeking secure online financial services
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Finance sites
Move from this single report into the broader market cluster.
Browse Banking sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
arvest.com
same_category
argenta.be
same_category
asr.nl
same_category
atlanticunionbank.com
same_category
See all alternatives
View all 6 alternatives and competitors to apsbank.com.mt.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.