Skip to main content
Screenshot of askmeclassifieds.com

Live website intelligence

askmeclassifieds.com

Contact Support

Last refresh

Updated 15d ago

Analyst read

Spammy

65/100 trustBusiness & IndustrialStale snapshot

Detected stack

Cloudflare

Quick read

How to read askmeclassifieds.com quickly

askmeclassifieds.com looks like business & industrial. Traffic signals point to roughly 44.8K monthly visits. Current AI trust scoring is 65/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

47/56 fields populated (84%)

11 providers

Providers with missing fields

publisher: 3/5files: 2/3traffic: 8/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 8/10

Missing: globalRank, countryRank

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Use the SEO tab as a quality and discoverability check

These metrics help you decide whether a site is structured clearly enough for search and users. Strong heading, linking, and technical file patterns usually indicate better discoverability.

  • Check heading counts to spot thin or messy structure.
  • Review robots and sitemap presence before treating a site as search-mature.
  • Use taxonomy and AI notes to understand topical fit.

Heading Structure

H1 Tags0
H2 Tags0
Images0

Link Analysis

Internal Links0
External Links0

Technical Files Checklist

robots.txt

File found and accessible

sitemap.xml

Sitemap found and valid

Single H1 Tag

Found 0 H1 tags

Meta Description

Missing meta description

Taxonomy

Business & IndustrialClassifieds75%
classifiedsadvertisingmarketplaceb2blocal-adsdomain-parkingsuspended

AI Classification

Content Analysis

CategoryBusiness & Industrial
Business ModelClassified Advertising Platform / Domain Parking
Trust Score65/100
SentimentSpammy

AI-Generated Tags

classifiedsadvertisingmarketplaceb2blocal-adsdomain-parkingsuspended

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.