Live website intelligence
الصحيفة
الصحيفة مؤسسة إعلامية مغربية يوجد مقرها بالرباط، تهتم بنشر أخبار حصرية ومباشرة تخص المغرب، ودول شمال إفريقيا، والشرق الأوسط،،مع مواكبة لأهم الأحداث الدولية من خلال تقارير، تحقيقات، آراء، صور وفيديوهات عبر صحافييها ومراسليها في خمس دول. وتهم الصحيفة بمواكبة الأحداث السياسية، والإقتصادية، مع نشر أخبار عن التكنولوجيا، والعلوم، والصحة، والفنون، والرياضة، وغيرها.
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
assahifa.com looks like news & weather. Traffic signals point to roughly 770.2K monthly visits. Current AI trust scoring is 15/100.
What to do next
51/56 fields populated (91%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
Moroccan digital news media outlet based in Rabat, publishing exclusive news covering Morocco, North Africa, Middle East, and international events through reports, investigations, opinions, photos and videos via journalists in five countries
Ad Systems
Monetization Signals
Digital Media / Online News Publisher model detected
Low trust with 15/100 score
Arabic-speaking readers interested in Moroccan, North African, and Middle Eastern news, politics, economics, technology, science, health, arts, and sports
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse News & Weather sites
Move from this single report into the broader market cluster.
Browse International News sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
adfontesmedia.com
same_category
18porn.sex
similar_rank_band
actividadesdeinfantilyprimaria.com
similar_rank_band
agorarn.com.br
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to assahifa.com.