Live website intelligence
Малый бизнес в России. Регистрация, налоги, бухгалтерия, персонал, документы
Ассистент успеха - сайт, предназначенный для предпринимателей с целью помочь вести бухгалтерский учёт, сдавать отчёты, трудоустраивать персонал.
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
assistentus.ru looks like business and finance. Traffic signals point to roughly 2.1M monthly visits. Current AI trust scoring is 15/100.
What to do next
45/56 fields populated (80%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
Russian online service providing comprehensive business assistance for small businesses including accounting, tax reporting, HR management, legal documentation, and business registration
Ad Systems
Monetization Signals
B2B Information Service / SaaS Hybrid (content platform with potential subscription tools) model detected
Low trust with 15/100 score
Small business owners, entrepreneurs, accountants, and HR professionals in Russia seeking compliance and operational guidance
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Business and Finance sites
Move from this single report into the broader market cluster.
Browse Small Business sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
agorarn.com.br
similar_rank_band
22places.de
similar_rank_band
actividadesdeinfantilyprimaria.com
similar_rank_band
okcdn.ru
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to assistentus.ru.