Live website intelligence
Astromart
Astromart.com is the leading portal for astronomy news, classified ads and telescope reviews. Place your astronomy ads, read the latest news articles and check out the current reviews of newest telescopes and equipment.
Last refresh
Updated 14d ago
Analyst read
Professional
#682.8K global rank15/100 trustScienceStale snapshot
Detected stack
Cloudflare
Quick read
How to read astromart.com quickly
astromart.com looks like science. Traffic signals point to roughly 38.1K monthly visits. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
51/56 fields populated (91%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Astromart is a specialized online portal serving the astronomy community with news, classified advertisements for telescopes and equipment, product reviews, and forums. It functions as a marketplace and information hub for amateur and professional astronomers.
Business ModelClassifieds Marketplace + Media/Publishing
Target AudienceAmateur astronomers, astrophotography enthusiasts, telescope buyers/sellers, space enthusiasts, and astronomy hobbyists
Classification
CategoryScience
Sub-CategoryAstronomy
astronomytelescopesclassifiedsnewsreviewsspaceequipmenthobbyamateur astronomy
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleTraditional/Classic Portal
VibeEstablished, Community-focused, Informational
UI Score5/100
Detected Logo TextAstromart
IAB Taxonomy
IAB CategoryScience
IAB Sub-CategoryAstronomy
Confidence95%
astronomytelescopesclassifiedsnewsreviewsspaceequipmenthobbyamateur astronomy
Business Insights
Business Model
Classifieds Marketplace + Media/Publishing model detected
Trust Level
Low trust with 15/100 score
Audience
Amateur astronomers, astrophotography enthusiasts, telescope buyers/sellers, space enthusiasts, and astronomy hobbyists
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Science sites
Move from this single report into the broader market cluster.
Browse Astronomy sites
Use the topic route when audience and editorial intent matter more than category.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
agenciasinc.es
same_category
apsnet.org
same_category
arvojournals.org
same_category
awi.de
same_category
See all alternatives
View all 6 alternatives and competitors to astromart.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.