Live website intelligence
Australia-wide Online Student Community | ATAR Notes
For the VCE, HSC, QCE and WACE, ATAR Notes deliver free, high-quality notes, guides, tips, tricks, lectures, and more. Ace your studies - join today!
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
atarnotes.com looks like education. Traffic signals point to roughly 188.2K monthly visits. Current AI trust scoring is 5/100.
What to do next
51/56 fields populated (91%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
This page lists websites that share audience, category, or technology overlap with the current domain. Use it to discover competitors, substitutes, and adjacent players.
Accueil | Acfas
Aarhus Universitet
6PM | OFFICIAL WEBSITE
Filo: The World's Best Study Help
10FastFingers.com - Typing Test, Competitions, Practice & Typing Games
FAQ
Common questions about finding and comparing alternatives.
This page lists websites that share audience, category, or technology overlap with atarnotes.com. Each alternative includes a match score and reasons so you can evaluate relevance quickly.
Alternatives are identified using a combination of category taxonomy, technology stack overlap, traffic patterns, and audience similarity signals from the SiteJSON analysis pipeline.
Yes. Click any alternative to open its full report, or use the compare feature to see atarnotes.com side by side with a competitor.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse React websites
Pivot from one domain into a stack-based discovery path.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
accelerate-ed.com
same_category
2books.su
same_category
actividadesdeinfantilyprimaria.com
same_category
acfas.ca
same_category