Quick read
How to read autohebdo.net quickly
autohebdo.net looks like automotive. Traffic signals point to roughly 1.5M monthly visits. Current AI trust scoring is 10/100.
What to do next
- Technology detection is incomplete, so infrastructure clues may be more useful than stack tags.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
33/56 fields populated (59%)
Providers with missing fields
visual: 0/4meta: 0/3seo: 0/5ads: 0/5publisher: 3/5files: 2/3radar: 2/4ai: 6/7
View field-level status
visual: 0/4
Missing: screenshotUrl, dominantColor, palette, storage
meta: 0/3
Missing: title, description, techStackDetected
seo: 0/5
Missing: h1Count, h2Count, internalLinks, externalLinks, imagesCount
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Start here before opening deeper tabs
This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.
- Use the SEO card to judge structure quality.
- Use traffic and rank signals to estimate market weight.
- Use business and trust modules before outreach or partnership decisions.
DNS & Infrastructure
DNS ProviderGoogle
Mail (MX)0 autohebdo-net.mail.protection.outlook.com
NS Records4 records
TXT Records10 records
Traffic Stats
Monthly Visits1.5M
Bounce Rate34.00%
Avg Visit Duration4m 43.829999999999984s
Pages per Visit7.2
Top CountryCA
Global Rank#26.1K
Country Rank#642
Domain Age25.4 years
Taxonomy
IAB CategoryAutomotive
IAB Sub-CategoryAuto Buying and Selling
Confidence95%
automotiveclassifiedsmarketplacecarsused carsauto sales
Technical Files
robots.txtMissing
sitemap.xmlMissing
AI Analysis
SummaryAn online automotive marketplace facilitating the sale and purchase of new and used vehicles.
Business ModelClassifieds / Marketplace
Trust Score10/100
SentimentProfessional
Publisher / Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Automotive sites
Move from this single report into the broader market cluster.
Browse Auto Buying and Selling sites
Use the topic route when audience and editorial intent matter more than category.
Open Industry Categories
Best for competitor research, market mapping, and account qualification.
autodoc.dk
same_category
1gai.ru
same_category
anwb.nl
same_category
autohotarek.cz
same_category
See all alternatives
View all 6 alternatives and competitors to autohebdo.net.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.