Live website intelligence
Kredit. Einfach. Online. | auxmoney
Kredit. Einfach. Online. Das ist auxmoney. Schnell & einfach Geld leihen ✓ Auch für Selbständige ✓ Jetzt kostenlos Kredit anfragen
Last refresh
Updated 14d ago
Analyst read
Professional
#97.9K global rank5/100 trustFinanceStale snapshot
Detected stack
WordPress
Quick read
How to read auxmoney.com quickly
auxmoney.com looks like finance. Traffic signals point to roughly 421.6K monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
50/56 fields populated (89%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4ai: 6/7
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
auxmoney is a digital platform that connects borrowers seeking personal loans with private investors, bypassing traditional banking structures.
Business ModelP2P Lending Platform / Fintech Marketplace
Target AudienceIndividuals and self-employed professionals seeking fast, online credit solutions; Private investors looking to fund loans.
Classification
CategoryFinance
Sub-CategoryBanking & Personal Finance
LoansFintechPeer-to-Peer LendingOnline BankingCredit
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
IAB Taxonomy
IAB CategoryFinance
IAB Sub-CategoryBanking & Personal Finance
Confidence95%
LoansFintechPeer-to-Peer LendingOnline BankingCredit
Business Insights
Business Model
P2P Lending Platform / Fintech Marketplace model detected
Trust Level
Low trust with 5/100 score
Audience
Individuals and self-employed professionals seeking fast, online credit solutions; Private investors looking to fund loans.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Finance sites
Move from this single report into the broader market cluster.
Browse Banking & Personal Finance sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
ameritas.com
same_category
agorarn.com.br
similar_rank_band
22places.de
similar_rank_band
actividadesdeinfantilyprimaria.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to auxmoney.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.