Live website intelligence
AVID Open Access – Resources to Accelerate, Inspire, and Empower
AVID Open Access offers grab-and-go online teaching tools and STEM resources for K-12 virtual learning. Free curated lessons for your classroom!
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
avidopenaccess.org looks like education. Traffic signals point to roughly 61.3K monthly visits. Current AI trust scoring is 5/100.
What to do next
50/56 fields populated (89%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
agrobiologie.cz
same_category
activatelearningdigital.com
same_category
actividadesdeinfantilyprimaria.com
same_category
47-detsad.ru
same_category
See all alternatives
View all 6 alternatives and competitors to avidopenaccess.org.