Skip to main content
Screenshot of avto.net

Live website intelligence

avto.net

Attention Required! | Cloudflare

Last refresh

Updated 15d ago

Analyst read

Professional

20/100 trustAutomotiveStale snapshot

Detected stack

Cloudflare

Quick read

How to read avto.net quickly

avto.net looks like automotive. Traffic signals point to roughly 5.5M monthly visits. Current AI trust scoring is 20/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

42/56 fields populated (75%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 8/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 8/10

Missing: globalRank, countryRank

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags1
H2 Tags3
Internal Links0
External Links1
Images0

DNS & Infrastructure

DNS ProviderGoogle
Mail (MX)0 avto-net.mail.protection.outlook.com
NS Records2 records
TXT Records3 records

Traffic Stats

Monthly Visits5.5M
Bounce Rate21.00%
Avg Visit Duration10m 6.080000000000041s
Pages per Visit15.9
Top CountrySI
Domain Age28.2 years

Taxonomy

IAB CategoryAutomotive
IAB Sub-CategoryAuto Buying & Selling
Confidence75%
automotiveclassifiedsmarketplacecarsblockedcloudflaresecurity

Technical Files

robots.txtFound
sitemap.xmlMissing

AI Analysis

SummaryAvto.net appears to be an automotive classifieds marketplace, likely focused on car sales and listings in a European market (suggested by 'avto' which means 'car' in several Slavic languages). The site is currently blocking access via Cloudflare security protection.
Business ModelClassifieds/Marketplace
Trust Score20/100
SentimentProfessional

Publisher / Monetization

ads.txtFound
Ad Systems
avto.netgoogle.comadform.comiprom.netsmartyads.comcriteo.comthemediagrid.comrtbhouse.compubmatic.comrubiconproject.combetweendigital.comcontextweb.come-planning.netlijit.comlunamedia.ioonetag.comrichaudience.comsmartadserver.comvidoomy.comxapads.comappnexus.cominmobi.comkrushmedia.comopenx.comsovrn.comvideo.unrulymedia.comamxrtb.comindexexchange.comyahoo.comnextmillennium.ioadmagnetix.io33across.comsonobi.comyieldmo.comconnectad.io152media.infoadtelligent.combidmatic.iojfacassoc.commarkappmedia.sitemedia.netorangeclickmedia.comxandr.comadcolony.comadmanmedia.comadyoulike.comappads.inaxonix.comdistrictm.io
Monetization Signals
has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#100100100
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.