Skip to main content
Screenshot of birdsforsale.online

Live website intelligence

birdsforsale.online

Default page

Last refresh

Updated 8h ago

Analyst read

Spammy

65/100 trustPets

Detected stack

WordPress

Quick read

How to read birdsforsale.online quickly

birdsforsale.online looks like pets. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 65/100.

What to do next

  • The stack appears to include WordPress.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

38/56 fields populated (68%)

11 providers

Providers with missing fields

publisher: 3/5files: 2/3traffic: 0/10radar: 0/4ai: 6/7
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 6/7

Missing: aiAnalysis.visualAnalysis

Why this module matters

Business signals help answer “is this a real opportunity?”

Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.

  • Trust score and sentiment are your first risk screen.
  • Business summary and audience notes speed up qualification.
  • Ads and monetization patterns reveal how the site captures value.

Business Intelligence

Business Profile

A domain appearing to facilitate the sale of birds, currently presenting a default parking or setup page.

Business ModelClassifieds/Marketplace
Target AudienceBird enthusiasts and potential pet owners

Classification

CategoryPets
Sub-CategoryPet Food and Supplies
birdspetsmarketplaceclassifiedswordpress

Trust & Risk

Trust Assessment

Trust Score65/100
SentimentSpammy
Spam DetectionFlagged

Google Ads Transparency

Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results

Publisher Monetization

ads.txtMissing

Monetization Signals

missing_ads_txt

IAB Taxonomy

IAB CategoryPets
IAB Sub-CategoryPet Food and Supplies
Confidence85%
birdspetsmarketplaceclassifiedswordpress

Business Insights

Business Model

Classifieds/Marketplace model detected

Trust Level

Medium trust with 65/100 score

Audience

Bird enthusiasts and potential pet owners

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.