Quick read
How to read butterflycircle.com quickly
butterflycircle.com looks like science. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
34/56 fields populated (61%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Butterfly Circle is a community-driven website and forum dedicated to butterfly enthusiasts, photographers, and naturalists, particularly focused on Malaysian butterflies. It provides educational content on butterfly photography techniques, species identification, and serves as a platform for members to share observations and request ID help.
Business ModelCommunity Forum / Non-profit Educational Platform
Target AudienceButterfly enthusiasts, nature photographers, lepidopterists, wildlife conservationists, and amateur naturalists in Malaysia and Southeast Asia
Classification
CategoryScience
Sub-CategoryNature & Wildlife
butterfliesnature photographywildlifeinsectsmalaysiacommunity forumcitizen sciencenature conservation
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleTraditional Forum/Portal
VibeCommunity-focused, Educational, Nostalgic
UI Score4/100
Detected Logo TextButterfly Circle - a tribute to nature's flying jewels
IAB Taxonomy
IAB CategoryScience
IAB Sub-CategoryNature & Wildlife
Confidence92%
butterfliesnature photographywildlifeinsectsmalaysiacommunity forumcitizen sciencenature conservation
Business Insights
Business Model
Community Forum / Non-profit Educational Platform model detected
Trust Level
Low trust with 5/100 score
Audience
Butterfly enthusiasts, nature photographers, lepidopterists, wildlife conservationists, and amateur naturalists in Malaysia and Southeast Asia
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Science sites
Move from this single report into the broader market cluster.
Browse Nature & Wildlife sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
aejrpage.com
same_category
nature.com
same_category
mdpi.com
same_category
apa.org
same_category
See all alternatives
View all 6 alternatives and competitors to butterflycircle.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.