Skip to main content
Screenshot of cargambia.com

Live website intelligence

cargambia.com

Buy and sell cars, motorbikes and trucks in The Gambia - CarGambia

Buy and sell cars, motorbikes and trucks in The Gambia with CarGambia.com

Last refresh

Updated 13d ago

Analyst read

Professional

15/100 trustAutomotiveStale snapshot

Detected stack

Cloudflare

Quick read

How to read cargambia.com quickly

cargambia.com looks like automotive. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

42/56 fields populated (75%)

11 providers

Providers with missing fields

traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 5/5

All expected fields present

files: 3/3

All expected fields present

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags0
H2 Tags7
Internal Links192
External Links5
Images128

DNS & Infrastructure

DNS ProviderGoogle
NS Records5 records
TXT Records1 record

Traffic Stats

Domain Age8.5 years

Taxonomy

IAB CategoryAutomotive
IAB Sub-CategoryVehicle Shopping
Confidence95%
automotivemarketplaceclassifiedscarsgambiaafricaecommercevehicles

AI Analysis

SummaryCarGambia is an online automotive marketplace operating in The Gambia, enabling users to buy and sell cars, motorbikes, and trucks. The platform functions as a classifieds site with search filters for brand, model, city, price range, and condition.
Business ModelClassifieds Marketplace (C2C/B2C)
Trust Score15/100
SentimentProfessional

Advertising

Is AdvertiserNo
Result Count0
no_advertiser_idno_creative_results

Publisher / Monetization

ads.txtFound
Ad Systems
google.com
Direct Sellers1
Reseller Sellers0
Monetization Signals
has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#f0f0100
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.