Skip to main content
Screenshot of casa-cinema.click

Live website intelligence

casa-cinema.click

CasaCinema - Il tuo Cinema Streaming Numero UNO

Scopri CasaCinema il tuo sito dedicato al Cinema casalingo, dove puoi guardare in comodità tutti i film in streaming senza andare al cinema e pagare, tutto gratis in Italiano e Sub iTA.

Last refresh

Updated 17d ago

Analyst read

Spammy

85/100 trustArts & EntertainmentStale snapshot

Detected stack

Cloudflare

Quick read

How to read casa-cinema.click quickly

casa-cinema.click looks like arts & entertainment. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 85/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

42/56 fields populated (75%)

11 providers

Providers with missing fields

traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 5/5

All expected fields present

publisher: 5/5

All expected fields present

files: 3/3

All expected fields present

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags0
H2 Tags3
Internal Links123
External Links150
Images2

DNS & Infrastructure

DNS ProviderCloudflare
NS Records2 records

Traffic Stats

Domain Age0.2 years

Taxonomy

IAB CategoryArts & Entertainment
IAB Sub-CategoryMovies
Confidence95%
streamingmoviesfree-contentitalianpiracytv-seriesfilm

Technical Files

robots.txtFound
sitemap.xmlFound

AI Analysis

SummaryUnauthorized movie and TV streaming platform offering free access to copyrighted content in Italian, including films and TV series with Italian subtitles/dubbing
Business ModelAd-supported piracy/streaming aggregator
Trust Score85/100
SentimentSpammy

Advertising

Is AdvertiserNo
Result Count0
no_advertiser_idno_creative_results

Publisher / Monetization

ads.txtMissing
Direct Sellers0
Reseller Sellers0
Monetization Signals
missing_ads_txt

Visual / Brand

Dominant Color#00a0100
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.