Quick read
How to read fliqlo.app quickly
fliqlo.app looks like technology & computing. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 44/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
32/62 fields populated (52%)
1 health alerts11 providers
Providers with missing fields
meta: 2/3ads: 0/5publisher: 2/5files: 2/3traffic: 0/16radar: 0/4
Provider health alerts
traffic: TRAFFIC_NO_DATA
View field-level status
visual: 4/4
All expected fields present
meta: 2/3
Missing: description
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Fliqlo is a popular flip clock screensaver and time display application known for its minimalist retro aesthetic. The .app domain suggests a focus on application/software distribution.
Business ModelFreemium Software / Utility App
Target AudienceDesign-conscious users, productivity enthusiasts, and individuals seeking aesthetic time displays for screensavers or desktop widgets
Classification
CategoryTechnology & Computing
Sub-CategorySoftware
flip-clockscreensavertime-displayminimalistutility-app
Trust & Risk
Trust Assessment
Trust Score44/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleMinimalist
VibeUnder Construction
UI Score3/100
IAB Taxonomy
IAB CategoryTechnology & Computing
IAB Sub-CategorySoftware
Confidence60%
flip-clockscreensavertime-displayminimalistutility-app
Business Insights
Business Model
Freemium Software / Utility App model detected
Trust Level
Medium trust with 44/100 score
Audience
Design-conscious users, productivity enthusiasts, and individuals seeking aesthetic time displays for screensavers or desktop widgets
Keep exploring
Keep exploring from this report
Browse the related category, topic, or technology path, open alternatives, or move into comparison when you have a second domain.
Related category
Browse Technology & Computing sites
Move from this site data report into the broader market cluster.
Use category pages when market context matters more than one domain.
Related topic
Browse Software sites
Use the topic route when audience and editorial intent matter more than category.
Topic pages help you compare audience intent around the same domain.
Related technology
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
Technology pages help you compare implementation patterns across similar sites.
Alternatives
Open fliqlo.app alternatives
Review similar domains ranked by category, audience, technology overlap, and match reasons.