Quick read
How to read fragment.com quickly
fragment.com looks like technology & computing. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
34/56 fields populated (61%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Fragment is a blockchain-based marketplace for buying and selling Telegram usernames as collectible digital assets. Users can secure unique usernames and assign them to personal accounts, channels, or groups through TON blockchain integration.
Business ModelNFT Marketplace / Digital Asset Exchange
Target AudienceTelegram power users, cryptocurrency enthusiasts, NFT collectors, businesses seeking branded usernames, and digital identity investors
Classification
CategoryTechnology & Computing
Sub-CategoryBlockchain & Cryptocurrency
telegramusernameauctionblockchaintoncryptocurrencynftdigital-identitymarketplace
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleMinimalist
VibeTrustworthy
UI Score8/100
Detected Logo TextFRAGMENT
IAB Taxonomy
IAB CategoryTechnology & Computing
IAB Sub-CategoryBlockchain & Cryptocurrency
Confidence95%
telegramusernameauctionblockchaintoncryptocurrencynftdigital-identitymarketplace
Business Insights
Business Model
NFT Marketplace / Digital Asset Exchange model detected
Trust Level
Low trust with 15/100 score
Audience
Telegram power users, cryptocurrency enthusiasts, NFT collectors, businesses seeking branded usernames, and digital identity investors
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Technology & Computing sites
Move from this single report into the broader market cluster.
Browse Blockchain & Cryptocurrency sites
Use the topic route when audience and editorial intent matter more than category.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
interlinklabs.ai
same_category
interencheres.com
same_category
ipfs.io
same_category
huggingface.co
same_category
See all alternatives
View all 6 alternatives and competitors to fragment.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.