Skip to main content
Screenshot of gamesqf.com

Live website intelligence

gamesqf.com

NewsHub - Your Daily Insights

Last refresh

Updated 6d ago

Analyst read

Professional

35/100 trustNews & Weather

Detected stack

Cloudflare

Quick read

How to read gamesqf.com quickly

gamesqf.com looks like news & weather. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 35/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags2
H2 Tags7
Internal Links0
External Links0
Images61

DNS & Infrastructure

DNS ProviderCloudflare
NS Records2 records

Traffic Stats

Domain Age1.5 years

Taxonomy

IAB CategoryNews & Weather
IAB Sub-CategoryGeneral News
Confidence85%
newshealthtechfinancelifestylepharmaceuticalsprescription drugs

Technical Files

robots.txtMissing
sitemap.xmlMissing

AI Analysis

SummaryNewsHub appears to be a general news aggregation or content portal covering multiple verticals including health, technology, finance, and lifestyle. The domain 'gamesqf.com' suggests potential domain mismatch or repurposing, with the site presenting as a professional news platform despite the gaming-related domain name.
Business ModelMedia / Content Publishing
Trust Score35/100
SentimentProfessional

Publisher / Monetization

ads.txtFound
Ad Systems
google.com
Monetization Signals
has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#101010
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.