Quick read
infoescola.com looks like education. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 18/100.
What to do next
41/56 fields populated (73%)
Providers with missing fields
visual: 3/4
Missing: screenshotUrl
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 5/5
All expected fields present
files: 3/3
All expected fields present
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Use rank, visits, geography, and engagement signals together. No single metric is enough, but the combination is useful for prioritization and market sizing.
—
—
—
Monthly
—
—
—
Domain Age
20.1 years
Registrar
Amazon Registrar, Inc.
Created At
Feb 08, 2006, 12:03 PM
Updated At
Dec 25, 2024, 11:16 PM
Expires At
Feb 08, 2027, 12:03 PM
Nameservers
Status
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
actividadesdeinfantilyprimaria.com
same_category
harvard.edu
same_category
stanford.edu
same_category
berkeley.edu
same_category
See all alternatives
View all 6 alternatives and competitors to infoescola.com.