Live website intelligence
Online Pharmacy Ireland | Next Day Delivery | Inish Pharmacy
Shop Ireland’s best-reviewed online pharmacy. Get next-day delivery on medicines, vitamins, and skincare. Registered Irish pharmacists available for advice.
Last refresh
Updated 9h ago
Analyst read
Professional
22/100 trustHealth & Fitness
Detected stack
ReactShopify
Quick read
How to read inishpharmacy.com quickly
inishpharmacy.com looks like health & fitness. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 22/100.
What to do next
- The stack appears to include React, Shopify.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
41/56 fields populated (73%)
Providers with missing fields
visual: 3/4traffic: 0/10radar: 0/4
View field-level status
visual: 3/4
Missing: screenshotUrl
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 5/5
All expected fields present
files: 3/3
All expected fields present
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Use the SEO tab as a quality and discoverability check
These metrics help you decide whether a site is structured clearly enough for search and users. Strong heading, linking, and technical file patterns usually indicate better discoverability.
- Check heading counts to spot thin or messy structure.
- Review robots and sitemap presence before treating a site as search-mature.
- Use taxonomy and AI notes to understand topical fit.
Heading Structure
H1 Tags1
H2 Tags18
Images74
Link Analysis
Internal Links329
External Links26
Link Ratio93% internal
Technical Files Checklist
robots.txt
File found and accessible
sitemap.xml
Sitemap found and valid
Single H1 Tag
Page has exactly one H1
Meta Description
Meta description present
Taxonomy
Health & FitnessPharmacy97%
online pharmacymedicinesvitaminsskincareirelande-commercehealth productsnext-day delivery
AI Classification
Content Analysis
CategoryHealth & Fitness
Business ModelE-commerce
Trust Score22/100
SentimentProfessional
AI-Generated Tags
online pharmacymedicinesvitaminsskincareirelande-commercehealth productsnext-day delivery
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Health & Fitness sites
Move from this single report into the broader market cluster.
Browse Pharmacy sites
Use the topic route when audience and editorial intent matter more than category.
Browse React websites
Pivot from one domain into a stack-based discovery path.
Browse Shopify websites
Pivot from one domain into a stack-based discovery path.
innerbuddies.com
same_category
internetaptieka.lv
same_category
innerbody.com
same_category
inlifehealthcare.com
same_category
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.