Live website intelligence
Kostenlose Kleinanzeigen in Deutschland | markt.de
✓ Kostenlose und schnelle Anzeigenaufgabe ✓ In Millionen gewerblichen und privaten Kleinanzeigen suchen ✓ Neu oder gebraucht ✓ In Deutschland und Umgebung
Last refresh
Updated 48d ago
Analyst read
Professional
15/100 trustShopping & ClassifiedsStale snapshot
Detected stack
Unknown
Quick read
How to read markt.de quickly
markt.de looks like shopping & classifieds. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
28/56 fields populated (50%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3traffic: 0/10whois: 0/6radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
German online classifieds marketplace for private and commercial listings across categories including vehicles, real estate, electronics, jobs, and services. Offers free ad posting with ad-supported or subscription-based access models.
Business ModelClassifieds Marketplace (Freemium + Ad-Supported + Subscription)
Target AudienceGerman-speaking consumers and businesses seeking to buy, sell, or trade goods and services locally; private sellers and small businesses looking for free or low-cost advertising
Classification
CategoryShopping & Classifieds
Sub-CategoryClassifieds
classifiedsmarketplacegermanykleinanzeigenlocal-adsbuy-sellfree-listings
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtFound
Ad Systems
markt.degoogle.comsmartadserver.comopenx.compubmatic.comrubiconproject.comteads.tvsovrn.commedia.nettriplelift.comlijit.comappnexus.comyieldlab.netloopme.comindexexchange.comyoc.comimprovedigital.comsspx.techad-generation.jpdistrictm.iorhythmone.comsmaato.comgumgum.comadmanmedia.comrichaudience.comspotxchange.comspotx.tvadform.comxandr.comimpactify.iofreewheel.tvjustpremium.comvideo.unrulymedia.comtraffective.comaps.amazon.comviralize.comyieldmo.comcontextweb.comstroeer.comemxdgt.comthemediagrid.comsharethrough.com33across.comadyoulike.comoutbrain.comrisecodes.comcriteo.combidtellect.comsynacor.com
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleCorporate
VibeProfessional
UI Score6/100
Detected Logo Textmarkt.de
IAB Taxonomy
IAB CategoryShopping & Classifieds
IAB Sub-CategoryClassifieds
Confidence92%
classifiedsmarketplacegermanykleinanzeigenlocal-adsbuy-sellfree-listings
Business Insights
Business Model
Classifieds Marketplace (Freemium + Ad-Supported + Subscription) model detected
Trust Level
Low trust with 15/100 score
Audience
German-speaking consumers and businesses seeking to buy, sell, or trade goods and services locally; private sellers and small businesses looking for free or low-cost advertising
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Shopping & Classifieds sites
Move from this single report into the broader market cluster.
Browse Classifieds sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
bikroy.com
same_category
argentina-mop.com
high_tag_overlap
artstation.store
high_tag_overlap
accenta.tv
high_tag_overlap
See all alternatives
View all 6 alternatives and competitors to markt.de.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.