Skip to main content
Screenshot of nation.africa

Live website intelligence

nation.africa

Diaspora | Daily Nation

Last refresh

Updated 46d ago

Analyst read

Professional

5/100 trustNews & WeatherStale snapshot

Detected stack

Cloudflare

Quick read

How to read nation.africa quickly

nation.africa looks like news & weather. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 5/100.

What to do next

  • The stack appears to include Cloudflare.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags1
H2 Tags12
Internal Links144
External Links15
Images26

DNS & Infrastructure

DNS ProviderGoogle
Mail (MX)10 inbound-smtp.eu-west-1.amazonaws.com
NS Records2 records
TXT Records5 records

Traffic Stats

Domain Age8.6 years

Taxonomy

IAB CategoryNews & Weather
IAB Sub-CategoryNewspapers
Confidence98%
newsmediaafrican-newskenyadiasporajournalismdaily-nationeast-africa

Technical Files

robots.txtFound
sitemap.xmlFound

AI Analysis

SummaryDaily Nation is a leading East African newspaper and digital news platform owned by Nation Media Group. It provides comprehensive coverage of Kenyan, African, and international news with a specific focus on diaspora communities. The platform operates as a traditional media outlet with digital transformation, offering news, analysis, and multimedia content across politics, sports, business, and social issues.
Business ModelMedia/Publishing - Digital-first newspaper with subscription and advertising revenue models
Trust Score5/100
SentimentProfessional

Publisher / Monetization

ads.txtMissing
Monetization Signals
missing_ads_txt

Visual / Brand

Dominant Color#100100100
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.