Skip to main content
Screenshot of razer.com

Live website intelligence

razer.com

Razer United States | For Gamers. By Gamers.

Cutting-edge technology✅ Excellent engineering✅ Sustainable✅ Shop Razer

Last refresh

Updated 45d ago

Analyst read

Professional

5/100 trustTechnology & ComputingStale snapshot

Detected stack

Unknown

Quick read

How to read razer.com quickly

razer.com looks like technology & computing. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 5/100.

What to do next

  • The stack appears to include Unknown.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags1
H2 Tags4
Internal Links32
External Links557
Images13

DNS & Infrastructure

DNS ProviderGoogle
Mail (MX)1 razer-com.mail.protection.outlook.com
NS Records6 records
TXT Records26 records

Traffic Stats

Domain Age27.8 years

Taxonomy

IAB CategoryTechnology & Computing
IAB Sub-CategoryConsumer Electronics
Confidence95%
gamingperipheralshardwaree-commercelifestylevalentines-daypromotion

Technical Files

robots.txtFound
sitemap.xmlMissing

AI Analysis

SummaryRazer is a leading lifestyle brand for gamers, selling high-performance gaming hardware, software, and services including mice, keyboards, headsets, and laptops.
Business ModelE-commerce
Trust Score5/100
SentimentProfessional

Publisher / Monetization

ads.txtFound
Ad Systems
vungle.com152media.infoadform.compubmatic.comacexchange.co.kradcolony.comadelement.comadiiix.comadmanmedia.comadmixer.co.kradswizz.comadtiming.comadtonos.comadview.comadvlion.comalgorix.coaniview.comapp-stock.comappnexus.comaralego.comaxonix.combematterfull.combetweendigital.combidence.combidmachine.iobigo.sgblueseasx.comchartboost.comconsumable.comcontextweb.comconversantmedia.comcriteo.comdisplay.ioe-planning.netflat-ads.comfreewheel.tvgitberry.comgoogle.comgrowintech.coignitemediatech.comimprovedigital.comindexexchange.cominmobi.comiqzone.comkidoz.netlijit.comloopme.comlunamedia.iomars.mediamedia.net
Monetization Signals
has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#600000
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.