Live website intelligence

truck1.ke

Used trucks, heavy vehicles, passenger transport for sale - Truck1 Kenya

Find new & used trucks, vans and heavy machinery on Truck1 Kenya. ✅ Benefit from working with one of the largest commercial vehicle marketplaces. ✅ Over 200.000 classified ads for commercial vehicles.

Last refresh

Updated 40d ago

Analyst read

Professional

15/100 trustAutomotiveStale snapshot

Detected stack

React

Quick read

How to read truck1.ke quickly

truck1.ke looks like automotive. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.

What to do next

The stack appears to include React.
Open the Traffic tab if you need audience scale and geography before outreach.
Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4

View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

Use the SEO card to judge structure quality.
Use traffic and rank signals to estimate market weight.
Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags1

H2 Tags0

Internal Links649

External Links183

Images89

DNS & Infrastructure

DNS ProviderGoogle

NS Records4 records

TXT Records1 record

Traffic Stats

Domain Age5.3 years

Taxonomy

IAB CategoryAutomotive

IAB Sub-CategoryTrucks & Commercial Vehicles

Confidence95%

commercial vehiclestrucksmarketplaceclassifiedsheavy machinerytractor unitssemi-trailersB2Bautomotive salesKenya

Technical Files

robots.txtFound

sitemap.xmlMissing

AI Analysis

SummaryTruck1 is a European-origin online marketplace operating in Kenya for buying and selling used commercial vehicles, trucks, vans, and heavy machinery. It connects sellers with buyers through classified advertising and promotional services.

Business ModelClassifieds Marketplace / Two-sided Platform

Trust Score15/100

SentimentProfessional

Publisher / Monetization

ads.txtFound

Ad Systems

google.com

Monetization Signals

has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#100100100

Color Palette

StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Browse Automotive sites

Move from this single report into the broader market cluster.

Browse Trucks & Commercial Vehicles sites

Use the topic route when audience and editorial intent matter more than category.

Browse React websites

Pivot from one domain into a stack-based discovery path.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.