Skip to main content
Screenshot of vitalityactive.com

Live website intelligence

vitalityactive.com

Welcome - Vitality One -

Last refresh

Updated 57d ago

Analyst read

Professional

15/100 trustHealth & FitnessStale snapshot

Detected stack

Unknown

Quick read

How to read vitalityactive.com quickly

vitalityactive.com looks like health & fitness. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.

What to do next

  • The stack appears to include Unknown.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags1
H2 Tags3
Internal Links0
External Links5
Images2

DNS & Infrastructure

DNS ProviderOther
NS Records4 records
TXT Records3 records

Traffic Stats

Domain Age14.5 years

Taxonomy

IAB CategoryHealth & Fitness
IAB Sub-CategoryExercise & Fitness
Confidence60%
healthwellnessfitnessvitalityportalcorporate

Technical Files

robots.txtFound
sitemap.xmlFound

AI Analysis

SummaryVitality One appears to be a health and wellness platform or corporate wellness program, likely offering fitness-related services, health tracking, or employee wellness solutions. The 'Sign In' functionality suggests a member portal or subscription-based access.
Business ModelSaaS / Membership Platform
Trust Score15/100
SentimentProfessional

Publisher / Monetization

ads.txtMissing
Monetization Signals
missing_ads_txt

Visual / Brand

Dominant Color#100100100
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.