Live website intelligence
WebMD - Better information. Better health.
The leading source for trustworthy and timely health and medical news and information. Providing credible health information, supportive community, and educational services by blending award-winning expertise in content, community services, expert commentary, and medical review.
Last refresh
Updated 45d ago
Analyst read
Professional
#2.0K global rank5/100 trustHealth & WellnessStale snapshot
Detected stack
Cloudflare
Quick read
How to read webmd.com quickly
webmd.com looks like health & wellness. Traffic signals point to roughly 34.4M monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
45/56 fields populated (80%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3traffic: 9/10radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 9/10
Missing: trafficSources
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
WebMD is a leading digital health publisher providing trustworthy medical news, health information, symptom checking tools, drug databases, and doctor-finding services. It generates revenue through advertising, sponsored content, and enterprise solutions while maintaining editorial independence through medical review processes.
Business ModelMedia/Advertising (Ad-supported health content platform)
Target AudienceGeneral consumers seeking health information, patients researching conditions, caregivers, and health-conscious individuals
Classification
CategoryHealth & Wellness
Sub-CategoryHealth Information
healthmedicalwellnessfitnessnewssymptom-checkerdrug-informationconsumer-health
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtFound
Ad Systems
indexexchange.comrubiconproject.comamxrtb.comappnexus.comtriplelift.comgoogle.comopenx.commedia.netemxdgt.comonetag.compubmatic.comtrustx.orgthemediagrid.comaps.amazon.comdistrictm.iocontextweb.commediafuse.comsharethrough.comsovrn.comlijit.comloopme.combematterfull.comiqzone.comvideo.unrulymedia.comzetaglobal.netmyfeature.tvyeahmobi.comrhythmone.comyahoo.comadtech.comyieldmo.comadmanmedia.comconversantmedia.comteads.tvspotxchange.comspotx.tv33across.comsmartadserver.comliveintent.comaolcloud.netcoxmt.comgumgum.comsynacor.comonlinemediasolutions.comonomagic.comgetmediamx.comaudienciad.cominmobi.comadyoulike.com
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StyleEditorial
VibeTrustworthy
UI Score8/100
Detected Logo TextWebMD
IAB Taxonomy
IAB CategoryHealth & Wellness
IAB Sub-CategoryHealth Information
Confidence98%
healthmedicalwellnessfitnessnewssymptom-checkerdrug-informationconsumer-health
Business Insights
Business Model
Media/Advertising (Ad-supported health content platform) model detected
Trust Level
Low trust with 5/100 score
Audience
General consumers seeking health information, patients researching conditions, caregivers, and health-conscious individuals
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Health & Wellness sites
Move from this single report into the broader market cluster.
Browse Health Information sites
Use the topic route when audience and editorial intent matter more than category.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
69shuba.com
similar_rank_band
angelone.in
similar_rank_band
ankergames.net
similar_rank_band
auctionzip.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to webmd.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.