Quick read
adzu.edu.ph looks like education. Traffic signals point to roughly 216.6K monthly visits. Current AI trust scoring is 5/100.
What to do next
45/56 fields populated (80%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
This page lists websites that share audience, category, or technology overlap with the current domain. Use it to discover competitors, substitutes, and adjacent players.
Antioch University | Win One for Humanity
Anthroholic: Anthropology Learning Platform
Attention Required! | Cloudflare
Home | Antalya Bilim Üniversitesi
Just a moment...
Atatürk Üniversitesi – "Köklü üniversite, güçlü bilim, parlak gelecek."
FAQ
Common questions about finding and comparing alternatives.
This page lists websites that share audience, category, or technology overlap with adzu.edu.ph. Each alternative includes a match score and reasons so you can evaluate relevance quickly.
Alternatives are identified using a combination of category taxonomy, technology stack overlap, traffic patterns, and audience similarity signals from the SiteJSON analysis pipeline.
Yes. Click any alternative to open its full report, or use the compare feature to see adzu.edu.ph side by side with a competitor.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse Colleges & Universities sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
3d-universal.com
same_category
actividadesdeinfantilyprimaria.com
same_category
academicon.pl
same_category
activehistory.ca
same_category
See all alternatives
View all 6 alternatives and competitors to adzu.edu.ph.