Quick read
How to read adzu.edu.ph quickly
adzu.edu.ph looks like education. Traffic signals point to roughly 216.6K monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
45/56 fields populated (80%)
Providers with missing fields
publisher: 3/5files: 2/3whois: 0/6radar: 2/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 2/4
Missing: categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Ateneo de Zamboanga University is a private Catholic Jesuit university located in Zamboanga City, Philippines. Founded in 1912, it offers undergraduate and graduate programs across multiple disciplines.
Business ModelNon-profit Educational Institution
Target AudienceProspective students, current students, parents, alumni, faculty, researchers, and the local community in Western Mindanao region of the Philippines
Classification
CategoryEducation
Sub-CategoryColleges & Universities
universityhigher educationphilippinesjesuitacademiccollegeeducation
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleCorporate
VibeProfessional
UI Score4/100
Detected Logo TextAteneo de Zamboanga University
IAB Taxonomy
IAB CategoryEducation
IAB Sub-CategoryColleges & Universities
Confidence95%
universityhigher educationphilippinesjesuitacademiccollegeeducation
Business Insights
Business Model
Non-profit Educational Institution model detected
Trust Level
Low trust with 5/100 score
Audience
Prospective students, current students, parents, alumni, faculty, researchers, and the local community in Western Mindanao region of the Philippines
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse Colleges & Universities sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
3d-universal.com
same_category
actividadesdeinfantilyprimaria.com
same_category
academicon.pl
same_category
activehistory.ca
same_category
See all alternatives
View all 6 alternatives and competitors to adzu.edu.ph.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.