Live website intelligence
All2day - Dagens bedste tilbud & deals samlet ét sted
Få overblik over de bedste rabatter & deals. Fra restaurantbesøg og spaophold til shopping og oplevelser. Find nemt de bedste tilbud online.
Last refresh
Updated 15d ago
Analyst read
Professional
15/100 trustShopping & E-commerceStale snapshot
Detected stack
Unknown
Quick read
How to read all2day.dk quickly
all2day.dk looks like shopping & e-commerce. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
33/56 fields populated (59%)
Providers with missing fields
publisher: 3/5files: 2/3traffic: 0/10whois: 0/6radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
All2day is Denmark's largest deal aggregator portal that collects and curates daily offers, discounts, and deals across categories including dining, spa, travel, experiences, and shopping. It serves as a centralized platform where consumers can discover reduced-price offers from various merchants rather than buying directly through the site.
Business ModelAffiliate/Aggregator - Lead generation and affiliate marketing model earning commissions from referred sales to partner merchants
Target AudienceDanish consumers aged 25-55 seeking discounts on lifestyle experiences, dining, wellness, and travel; deal-conscious shoppers looking for savings on local services and products
Classification
CategoryShopping & E-commerce
Sub-CategoryCoupons & Deals
dealscouponsdiscountsmarketplacelocal-servicesrestaurantsspatravellifestyledenmarkaggregator
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleClean, Modern, Scandinavian Minimalist
VibeTrustworthy, Approachable, Organized
UI Score7/100
Detected Logo TextAll2day
IAB Taxonomy
IAB CategoryShopping & E-commerce
IAB Sub-CategoryCoupons & Deals
Confidence92%
dealscouponsdiscountsmarketplacelocal-servicesrestaurantsspatravellifestyledenmarkaggregator
Business Insights
Business Model
Affiliate/Aggregator - Lead generation and affiliate marketing model earning commissions from referred sales to partner merchants model detected
Trust Level
Low trust with 15/100 score
Audience
Danish consumers aged 25-55 seeking discounts on lifestyle experiences, dining, wellness, and travel; deal-conscious shoppers looking for savings on local services and products
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Shopping & E-commerce sites
Move from this single report into the broader market cluster.
Browse Coupons & Deals sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
groupondata.com
same_category
addshoppers.com
same_category
jd.com
same_category
januarytubs.store
same_category
See all alternatives
View all 6 alternatives and competitors to all2day.dk.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.