Live website intelligence
All2day - Dagens bedste tilbud & deals samlet ét sted
Få overblik over de bedste rabatter & deals. Fra restaurantbesøg og spaophold til shopping og oplevelser. Find nemt de bedste tilbud online.
Last refresh
Updated 15d ago
Analyst read
Professional
15/100 trustShopping & E-commerceStale snapshot
Detected stack
Unknown
Quick read
How to read all2day.dk quickly
all2day.dk looks like shopping & e-commerce. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
33/56 fields populated (59%)
Providers with missing fields
publisher: 3/5files: 2/3traffic: 0/10whois: 0/6radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 0/6
Missing: whois.registrar, whois.createdAt, whois.expiresAt, whois.nameservers, whois.status, domainAgeYears
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Use the SEO tab as a quality and discoverability check
These metrics help you decide whether a site is structured clearly enough for search and users. Strong heading, linking, and technical file patterns usually indicate better discoverability.
- Check heading counts to spot thin or messy structure.
- Review robots and sitemap presence before treating a site as search-mature.
- Use taxonomy and AI notes to understand topical fit.
Heading Structure
H1 Tags1
H2 Tags54
Images78
Link Analysis
Internal Links153
External Links56
Link Ratio73% internal
Technical Files Checklist
robots.txt
File found and accessible
sitemap.xml
Sitemap not found
Single H1 Tag
Page has exactly one H1
Meta Description
Meta description present
Taxonomy
Shopping & E-commerceCoupons & Deals92%
dealscouponsdiscountsmarketplacelocal-servicesrestaurantsspatravellifestyledenmarkaggregator
AI Classification
Content Analysis
CategoryShopping & E-commerce
Business ModelAffiliate/Aggregator - Lead generation and affiliate marketing model earning commissions from referred sales to partner merchants
Trust Score15/100
SentimentProfessional
AI-Generated Tags
dealscouponsdiscountsmarketplacelocal-servicesrestaurantsspatravellifestyledenmarkaggregator
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Shopping & E-commerce sites
Move from this single report into the broader market cluster.
Browse Coupons & Deals sites
Use the topic route when audience and editorial intent matter more than category.
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
groupondata.com
same_category
addshoppers.com
same_category
hintaopas.fi
same_category
huutokaupat.com
same_category
See all alternatives
View all 6 alternatives and competitors to all2day.dk.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.