Live website intelligence
Keyrings made from genuine Aircraft Material | Aviationtag
Aviationtag dismantles old airplanes and lets their outer skins start a new life as key rings or luggage tags. The Aviationtagss are strictly limited, provided with a serial number and aircraft information - and always unique.
Last refresh
Updated 6d ago
Analyst read
Professional
#445.4K global rank5/100 trustTravel
Detected stack
ShopifyCloudflare
Quick read
How to read aviationtag.com quickly
aviationtag.com looks like travel. Traffic signals point to roughly 70.3K monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include Shopify, Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
50/56 fields populated (89%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4ai: 6/7
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Start here before opening deeper tabs
This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.
- Use the SEO card to judge structure quality.
- Use traffic and rank signals to estimate market weight.
- Use business and trust modules before outreach or partnership decisions.
SEO Overview
H1 Tags1
H2 Tags18
Internal Links190
External Links23
Images53
DNS & Infrastructure
DNS ProviderMicrosoft
Mail (MX)10 mx01.hornetsecurity.com
20 mx02.hornetsecurity.com
30 mx03.hornetsecurity.com
40 mx04.hornetsecurity.com
NS Records3 records
TXT Records4 records
Traffic Stats
Monthly Visits70.3K
Bounce Rate37.00%
Avg Visit Duration0m 36.95s
Pages per Visit3.3
Top CountryUS
Global Rank#445.4K
Country Rank#87.8K
Domain Age10.2 years
Taxonomy
IAB CategoryTravel
IAB Sub-CategoryAir Travel
Confidence95%
aviationupcyclingkeyringsaircraft-skingiftslimited-editiontravel-accessoriescollectibles
Technical Files
robots.txtFound
sitemap.xmlFound
AI Analysis
SummaryAviationtag specializes in upcycling decommissioned aircraft parts into unique, serialized keyrings and luggage tags, giving new life to aviation history.
Business ModelE-commerce (DTC)
Trust Score5/100
SentimentProfessional
Advertising
Is AdvertiserYes
Advertiser Namesbordbar design GmbH
Advertiser IDsAR17126780776881324033
Result Count1
has_advertiser_idhas_creative_results
Publisher / Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
Visual / Brand
Dominant Color#80a0b0
Color Palette
StorageR2
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Travel sites
Move from this single report into the broader market cluster.
Browse Air Travel sites
Use the topic route when audience and editorial intent matter more than category.
Browse Shopify websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.