Live website intelligence
Keyrings made from genuine Aircraft Material | Aviationtag
Aviationtag dismantles old airplanes and lets their outer skins start a new life as key rings or luggage tags. The Aviationtagss are strictly limited, provided with a serial number and aircraft information - and always unique.
Last refresh
Updated 14d ago
Analyst read
Professional
#445.4K global rank5/100 trustTravelStale snapshot
Detected stack
ShopifyCloudflare
Quick read
How to read aviationtag.com quickly
aviationtag.com looks like travel. Traffic signals point to roughly 70.3K monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include Shopify, Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
50/56 fields populated (89%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4ai: 6/7
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Aviationtag specializes in upcycling decommissioned aircraft parts into unique, serialized keyrings and luggage tags, giving new life to aviation history.
Business ModelE-commerce (DTC)
Target AudienceAviation enthusiasts, frequent flyers, collectors, and gift shoppers seeking unique and sustainable accessories.
Classification
CategoryTravel
Sub-CategoryAir Travel
aviationupcyclingkeyringsaircraft-skingiftslimited-editiontravel-accessoriescollectibles
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserActive Advertiser
Advertiser Names
bordbar design GmbH
Advertiser IDs
AR17126780776881324033
Ad Count1
has_advertiser_idhas_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
IAB Taxonomy
IAB CategoryTravel
IAB Sub-CategoryAir Travel
Confidence95%
aviationupcyclingkeyringsaircraft-skingiftslimited-editiontravel-accessoriescollectibles
Business Insights
Business Model
E-commerce (DTC) model detected
Trust Level
Low trust with 5/100 score
Audience
Aviation enthusiasts, frequent flyers, collectors, and gift shoppers seeking unique and sustainable accessories.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Travel sites
Move from this single report into the broader market cluster.
Browse Air Travel sites
Use the topic route when audience and editorial intent matter more than category.
Browse Shopify websites
Pivot from one domain into a stack-based discovery path.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
aeroxplorer.com
same_category
acollectedman.com
similar_rank_band
aircambodia.com
same_category
aeropartner.aero
same_category
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.